#şekersizpancake

#Repost @simanindunyasi
• • • • • •
[ENG below]
Haaariiika bir tava keki (pancake) tarifiyle karşınızdayım! Daha önce de yapmıştım ve paylaşmıştım tarif @semaninsagliklimutfagi na ait bu sefer biraz değişiklikler yaptım🙋❤️ 1 ölçünün tarifini veriyorum fotoğraftaki 1,5 ölçü💖
🌟HİNDİSTAN CEVİZİ UNLU TAVA KEKİ🌟
🌸1 yemek kaşığı hind cevizi unu @naturelkapowders 🌸2 yumurta
🌸1 yk yoğurt
🌸1 çk karbonat üstüne 1-2 damla limon
🌸Çok az limon suyu ve limon kabuğu rendesi
🌸İri parçalar halinde ceviz
Hepsini karıştırıyoruuuz ve yağlanmış tavada normal pancake gibi kısık ateşte pişiriyoruz. Çok doyurucu ve lezzetli oluyor. İlk fotodaki gibi tahinli ( @konya_bozkir_tahin_dunyasi ) -meyveli olan tatlı hali de çok güzel ikinci fotoğraftaki peynirli olan tuzlu hali de,tamamen sizin damak tadınıza kalmış❤️
👉🏻I'm here with a greaattt pancake recipe! I did it and shared it before the original recipe is from @semaninsagliklimutfagi I just did some changings ❤️🙋
🌟COCONUT FLOUR PANCAKE🌟
🌸1 tablespoon coconut flour
🌸2 eggs
🌸1 tablespoon yoghurt
🌸1 teaspoon baking soda and lemon drop as baking powder
🌸A little lemon juice and peel
🌸Wallnut
Mix them alll and bake like a normal pancake💖 It is both delicious with tahini-fruit like on the first photo and salty with cheese like on the second photo❤️ #pancake #tavakeki #glutensizpancake #şekersizpancake #sağlıklıpancake #glutenfreepancake #sugarfreepancake #healthypancake #hindistancevizi #hindistanceviziunu #şekersiz #glutensiz #sugarfree #glutenfree #sdtarifler #healthy #sağlıklıbeslenme #sağlıklıyaşam #healthyrecipes #healthybreakfast #healthylife #sağlıklıtarifler #healthylifestyle #eatinghealthy #healthyeating #healthycooking
#Repost @simanindunyasi
• • • • • •
[ENG below]
Haaariiika bir tava keki (pancake) tarifiyle karşınızdayım! Daha önce de yapmıştım ve paylaşmıştım tarif @semaninsagliklimutfagi na ait bu sefer biraz değişiklikler yaptım🙋❤️ 1 ölçünün tarifini veriyorum fotoğraftaki 1,5 ölçü💖
🌟HİNDİSTAN CEVİZİ UNLU TAVA KEKİ🌟
🌸1 yemek kaşığı hind cevizi unu @naturelkapowders 🌸2 yumurta
🌸1 yk yoğurt
🌸1 çk karbonat üstüne 1-2 damla limon
🌸Çok az limon suyu ve limon kabuğu rendesi
🌸İri parçalar halinde ceviz
Hepsini karıştırıyoruuuz ve yağlanmış tavada normal pancake gibi kısık ateşte pişiriyoruz. Çok doyurucu ve lezzetli oluyor. İlk fotodaki gibi tahinli ( @konya_bozkir_tahin_dunyasi ) -meyveli olan tatlı hali de çok güzel ikinci fotoğraftaki peynirli olan tuzlu hali de,tamamen sizin damak tadınıza kalmış❤️
👉🏻I'm here with a greaattt pancake recipe! I did it and shared it before the original recipe is from @semaninsagliklimutfagi I just did some changings ❤️🙋
🌟COCONUT FLOUR PANCAKE🌟
🌸1 tablespoon coconut flour
🌸2 eggs
🌸1 tablespoon yoghurt
🌸1 teaspoon baking soda and lemon drop as baking powder
🌸A little lemon juice and peel
🌸Wallnut
Mix them alll and bake like a normal pancake💖 It is both delicious with tahini-fruit like on the first photo and salty with cheese like on the second photo❤️ #pancake #tavakeki #glutensizpancake #şekersizpancake #sağlıklıpancake #glutenfreepancake #sugarfreepancake #healthypancake #hindistancevizi #hindistanceviziunu #şekersiz #glutensiz #sugarfree #glutenfree #sdtarifler #healthy #sağlıklıbeslenme #sağlıklıyaşam #healthyrecipes #healthybreakfast #healthylife #sağlıklıtarifler #healthylifestyle #eatinghealthy #healthyeating #healthycooking
[ENG below]
Haaariiika bir tava keki (pancake) tarifiyle karşınızdayım! Daha önce de yapmıştım ve paylaşmıştım tarif @semaninsagliklimutfagi na ait bu sefer biraz değişiklikler yaptım🙋❤️ 1 ölçünün tarifini veriyorum fotoğraftaki 1,5 ölçü💖
🌟HİNDİSTAN CEVİZİ UNLU TAVA KEKİ🌟
🌸1 yemek kaşığı hind cevizi unu @naturelkapowders 🌸2 yumurta
🌸1 yk yoğurt
🌸1 çk karbonat üstüne 1-2 damla limon
🌸Çok az limon suyu ve limon kabuğu rendesi
🌸İri parçalar halinde ceviz
Hepsini karıştırıyoruuuz ve yağlanmış tavada normal pancake gibi kısık ateşte pişiriyoruz. Çok doyurucu ve lezzetli oluyor. İlk fotodaki gibi tahinli -meyveli olan tatlı hali de çok güzel ikinci fotoğraftaki peynirli olan tuzlu hali de,tamamen sizin damak tadınıza kalmış❤️
👉🏻I'm here with a greaattt pancake recipe! I did it and shared it before the original recipe is from @semaninsagliklimutfagi I just did some changings ❤️🙋
🌟COCONUT FLOUR PANCAKE🌟
🌸1 tablespoon coconut flour
🌸2 eggs
🌸1 tablespoon yoghurt
🌸1 teaspoon baking soda and lemon drop as baking powder
🌸A little lemon juice and peel
🌸Wallnut
Mix them alll and bake like a normal pancake💖 It is both delicious with tahini-fruit like on the first photo and salty with cheese like on the second photo❤️ #pancake #tavakeki #glutensizpancake #şekersizpancake #sağlıklıpancake #glutenfreepancake #sugarfreepancake #healthypancake #hindistancevizi #hindistanceviziunu #şekersiz #glutensiz #sugarfree #glutenfree #sdtarifler #healthy #sağlıklıbeslenme #sağlıklıyaşam #healthyrecipes #healthybreakfast #healthylife #sağlıklıtarifler #healthylifestyle #eatinghealthy #healthyeating #healthycooking #sağlıklı #yummy #photography #photooftheday
[ENG below]
Haaariiika bir tava keki (pancake) tarifiyle karşınızdayım! Daha önce de yapmıştım ve paylaşmıştım tarif @semaninsagliklimutfagi na ait bu sefer biraz değişiklikler yaptım🙋❤️ 1 ölçünün tarifini veriyorum fotoğraftaki 1,5 ölçü💖
🌟HİNDİSTAN CEVİZİ UNLU TAVA KEKİ🌟
🌸1 yemek kaşığı hind cevizi unu @naturelkapowders 🌸2 yumurta
🌸1 yk yoğurt
🌸1 çk karbonat üstüne 1-2 damla limon
🌸Çok az limon suyu ve limon kabuğu rendesi
🌸İri parçalar halinde ceviz
Hepsini karıştırıyoruuuz ve yağlanmış tavada normal pancake gibi kısık ateşte pişiriyoruz. Çok doyurucu ve lezzetli oluyor. İlk fotodaki gibi tahinli -meyveli olan tatlı hali de çok güzel ikinci fotoğraftaki peynirli olan tuzlu hali de,tamamen sizin damak tadınıza kalmış❤️
👉🏻I'm here with a greaattt pancake recipe! I did it and shared it before the original recipe is from @semaninsagliklimutfagi I just did some changings ❤️🙋
🌟COCONUT FLOUR PANCAKE🌟
🌸1 tablespoon coconut flour
🌸2 eggs
🌸1 tablespoon yoghurt
🌸1 teaspoon baking soda and lemon drop as baking powder
🌸A little lemon juice and peel
🌸Wallnut
Mix them alll and bake like a normal pancake💖 It is both delicious with tahini-fruit like on the first photo and salty with cheese like on the second photo❤️ #pancake #tavakeki #glutensizpancake #şekersizpancake #sağlıklıpancake #glutenfreepancake #sugarfreepancake #healthypancake #hindistancevizi #hindistanceviziunu #şekersiz #glutensiz #sugarfree #glutenfree #sdtarifler #healthy #sağlıklıbeslenme #sağlıklıyaşam #healthyrecipes #healthybreakfast #healthylife #sağlıklıtarifler #healthylifestyle #eatinghealthy #healthyeating #healthycooking #sağlıklı #yummy #photography #photooftheday
Reposted from @metropolde.1.kucuk.sifahane (@get_regrann) -  canı tatlı çekenlere ya da sabah çocuşlara çok basit hazırlanabilecek sağlıklı bir alternatif;
Unsuz, Rafine Şekersiz Pancake
Tarif;
🍀 2 yumurta
🍀 2 y.k. kinoa unu @naturelkapowders
🍀 2 y.k. hindistan cevizi unu 🍀 5 y.k. dut tozu @naturelkapowders
🍀 2 y.k. soğuk sıkım zeytinyağı
🍀 7 y.k. istediğiniz bir bitkisel süt (ben fındık sütü kullandım)
🍀 1 y.k. fındık sütünden kalan posa
🍀 1 ç.k. karbonat, 1 t.k. sirke
Karbonat ve sirkeyi bir kapta aktive edip kalan tüm malzemeleri üzerine ekleyip homojen olana kadar karıştırıyoruz.
Biraz zeytinyağı ile tavada kısık ateşte arkalı önlü pişiriyoruz.
Unsuz yaptığım en pufidik pancakeler oldu diyebilirim 😍 Dün akşam yemeğimiz kahvaltılık şeklinde oldu ve bu tatlışta masamızın favori parçasıydı 😂👌🏻
Nasıl servis edeceğiniz ise tamamen evde ki malzemelerinize kalıyor. Ben evde yoğurt yapımından kalan az bir kaymak, tahin pekmez karışımı ve meyvelerle lezzetine lezzet kattım 😊
Tadı damağımızda kaldı, her gün yapsak yenir cinsten 🙈 ama sonuçta sende bir kaçamaksın canım pancake 😋😅🙋🏻‍♀️
#temizbeslenme #sağlıklıyaşam #sağlıklıbeslenme #sağlık #bakliyat #protein #diyet #diyetteyiz #sporcubeslenmesi #fibromiyalji #lupus #multiplesclerosis #lyme #lymedisease #karabuğday #glutensiztarifler #glutensiz #pancake #şekersizpancake #unsuzpancake #kinoaunu #berrinatıştırmalık #berrinkahvaltısı - #regrann
Reposted from @metropolde.1.kucuk.sifahane (@get_regrann) - canı tatlı çekenlere ya da sabah çocuşlara çok basit hazırlanabilecek sağlıklı bir alternatif;
Unsuz, Rafine Şekersiz Pancake
Tarif;
🍀 2 yumurta
🍀 2 y.k. kinoa unu @naturelkapowders
🍀 2 y.k. hindistan cevizi unu 🍀 5 y.k. dut tozu @naturelkapowders
🍀 2 y.k. soğuk sıkım zeytinyağı
🍀 7 y.k. istediğiniz bir bitkisel süt (ben fındık sütü kullandım)
🍀 1 y.k. fındık sütünden kalan posa
🍀 1 ç.k. karbonat, 1 t.k. sirke
Karbonat ve sirkeyi bir kapta aktive edip kalan tüm malzemeleri üzerine ekleyip homojen olana kadar karıştırıyoruz.
Biraz zeytinyağı ile tavada kısık ateşte arkalı önlü pişiriyoruz.
Unsuz yaptığım en pufidik pancakeler oldu diyebilirim 😍 Dün akşam yemeğimiz kahvaltılık şeklinde oldu ve bu tatlışta masamızın favori parçasıydı 😂👌🏻
Nasıl servis edeceğiniz ise tamamen evde ki malzemelerinize kalıyor. Ben evde yoğurt yapımından kalan az bir kaymak, tahin pekmez karışımı ve meyvelerle lezzetine lezzet kattım 😊
Tadı damağımızda kaldı, her gün yapsak yenir cinsten 🙈 ama sonuçta sende bir kaçamaksın canım pancake 😋😅🙋🏻‍♀️
#temizbeslenme #sağlıklıyaşam #sağlıklıbeslenme #sağlık #bakliyat #protein #diyet #diyetteyiz #sporcubeslenmesi #fibromiyalji #lupus #multiplesclerosis #lyme #lymedisease #karabuğday #glutensiztarifler #glutensiz #pancake #şekersizpancake #unsuzpancake #kinoaunu #berrinatıştırmalık #berrinkahvaltısı - #regrann
Buttermilk kullanimi hakkinda sorulariniz icin, alternatif bir tarif paylasti Dilhun hanim 💕
Ellerinize saglik 💕😋
.
.
Posted @withrepost • @dilhunskitchen Kahvaltıların enn vazgeçilmeziii Pancake🤩 Dilhun usulü tarif olmadan olur muu??🥳
⭐️Şekersiz
⭐️Yağsız
⭐️Unsuz
⭐️Fit
🥞2 adet muz (yumuşamış ve olgun)
🥞1 su bardağı buttermilk @candardogaltatlar
🥞1 çay kaşığı kabartma tozu
🥞1 su bardağı yulaf unu @candardogaltatlar
Üstü için:
🥞Bal
🥛Muzlar püre haline gelene kadar çatalla ezilir. Geri kalan tüm malzemeler çırpıcıyla pürüzsüz olana kadar çırpılır.
🥛Yapışmaz tava ocağa alınır, altı ısıtılır. Pancake hamuru kepçe yardımıyla tavaya dökülür ve orta-kısık ateşte pişirilir. (tavanın büyüklüğüne göre tek seferde 3-4 pancake yapabilirsiniz)
🥛Baloncuklar çıkınca spatulayla ters çevilir.
🥛Servis tabağına alınır, üstüne bal gezdirilir.
#dilhunskitchen #buttermilk #pancake #şekersizpancake #şekersiztarifler #fitpancake #pancakerecipe #nosugar #sugarfree #şekersizpankek #pankektarifi #pankek #kahvaltılıkpankek #sugarfreepancakes
Buttermilk kullanimi hakkinda sorulariniz icin, alternatif bir tarif paylasti Dilhun hanim 💕
Ellerinize saglik 💕😋
.
.
Posted @withrepost • @dilhunskitchen Kahvaltıların enn vazgeçilmeziii Pancake🤩 Dilhun usulü tarif olmadan olur muu??🥳
⭐️Şekersiz
⭐️Yağsız
⭐️Unsuz
⭐️Fit
🥞2 adet muz (yumuşamış ve olgun)
🥞1 su bardağı buttermilk @candardogaltatlar
🥞1 çay kaşığı kabartma tozu
🥞1 su bardağı yulaf unu @candardogaltatlar
Üstü için:
🥞Bal
🥛Muzlar püre haline gelene kadar çatalla ezilir. Geri kalan tüm malzemeler çırpıcıyla pürüzsüz olana kadar çırpılır.
🥛Yapışmaz tava ocağa alınır, altı ısıtılır. Pancake hamuru kepçe yardımıyla tavaya dökülür ve orta-kısık ateşte pişirilir. (tavanın büyüklüğüne göre tek seferde 3-4 pancake yapabilirsiniz)
🥛Baloncuklar çıkınca spatulayla ters çevilir.
🥛Servis tabağına alınır, üstüne bal gezdirilir.
#dilhunskitchen #buttermilk #pancake #şekersizpancake #şekersiztarifler #fitpancake #pancakerecipe #nosugar #sugarfree #şekersizpankek #pankektarifi #pankek #kahvaltılıkpankek #sugarfreepancakes
Kahvaltıların enn vazgeçilmeziii Pancake🤩 Dilhun usulü tarif olmadan olur muu??🥳
⭐️Şekersiz
⭐️Yağsız
⭐️Unsuz
⭐️Fit
🥞2 adet muz (yumuşamış ve olgun)
🥞1 su bardağı buttermilk @candardogaltatlar
🥞1 çay kaşığı kabartma tozu
🥞1 su bardağı yulaf unu @candardogaltatlar
Üstü için:
🥞Bal
🥛Muzlar püre haline gelene kadar çatalla ezilir. Geri kalan tüm malzemeler çırpıcıyla pürüzsüz olana kadar çırpılır.
🥛Yapışmaz tava ocağa alınır, altı ısıtılır. Pancake hamuru kepçe yardımıyla tavaya dökülür ve orta-kısık ateşte pişirilir. (tavanın büyüklüğüne göre tek seferde 3-4 pancake yapabilirsiniz)
🥛Baloncuklar çıkınca spatulayla ters çevilir.
🥛Servis tabağına alınır, üstüne bal gezdirilir.
#dilhunskitchen #buttermilk #pancake #şekersizpancake #şekersiztarifler #fitpancake #pancakerecipe #nosugar #sugarfree #şekersizpankek #pankektarifi #pankek #kahvaltılıkpankek #sugarfreepancake
Kahvaltıların enn vazgeçilmeziii Pancake🤩 Dilhun usulü tarif olmadan olur muu??🥳
⭐️Şekersiz
⭐️Yağsız
⭐️Unsuz
⭐️Fit
🥞2 adet muz (yumuşamış ve olgun)
🥞1 su bardağı buttermilk @candardogaltatlar
🥞1 çay kaşığı kabartma tozu
🥞1 su bardağı yulaf unu @candardogaltatlar
Üstü için:
🥞Bal
🥛Muzlar püre haline gelene kadar çatalla ezilir. Geri kalan tüm malzemeler çırpıcıyla pürüzsüz olana kadar çırpılır.
🥛Yapışmaz tava ocağa alınır, altı ısıtılır. Pancake hamuru kepçe yardımıyla tavaya dökülür ve orta-kısık ateşte pişirilir. (tavanın büyüklüğüne göre tek seferde 3-4 pancake yapabilirsiniz)
🥛Baloncuklar çıkınca spatulayla ters çevilir.
🥛Servis tabağına alınır, üstüne bal gezdirilir.
#dilhunskitchen #buttermilk #pancake #şekersizpancake #şekersiztarifler #fitpancake #pancakerecipe #nosugar #sugarfree #şekersizpankek #pankektarifi #pankek #kahvaltılıkpankek #sugarfreepancake
🥞UNSUZ ŞEKERSİZ PANCAKE
🥞1 adet olgunlaşmış muz🍌, 1 yumurta 🥚, 2 tatlı kaşığı kakao, 4 yemek kaşığı yulaf ezmesi  ve 1 paket kabartma tozu👉🏻 tüm malzemeleri homojen bir karışım olana kadar blender yardımıyla karıştırıyorsunuz ve ısıttığınız yapışmaz tavada yağ eklemeden pişiriyorsunuz.
🥞Ben yarım muz 🍌, ceviz ve balla 🍯 birlikte servis yaptım, dikerseniz farlı meyveler de kullanabilirsiniz.
🥞İki kişilik hem tatlı hem de sağlıklı bir ara öğün seçeneği💁🏻‍♀️ #sağlıklıtarifler #şekersizpancake #sağlıklıtatlılar #pancakes #healtydessert #healthylifestyle
🥞UNSUZ ŞEKERSİZ PANCAKE
🥞1 adet olgunlaşmış muz🍌, 1 yumurta 🥚, 2 tatlı kaşığı kakao, 4 yemek kaşığı yulaf ezmesi ve 1 paket kabartma tozu👉🏻 tüm malzemeleri homojen bir karışım olana kadar blender yardımıyla karıştırıyorsunuz ve ısıttığınız yapışmaz tavada yağ eklemeden pişiriyorsunuz.
🥞Ben yarım muz 🍌, ceviz ve balla 🍯 birlikte servis yaptım, dikerseniz farlı meyveler de kullanabilirsiniz.
🥞İki kişilik hem tatlı hem de sağlıklı bir ara öğün seçeneği💁🏻‍♀️ #sağlıklıtarifler #şekersizpancake #sağlıklıtatlılar #pancakes #healtydessert #healthylifestyle
Sağlıklı PANCAKE 🥞

Kahvaltımızın vazgeçilmezi , doyurucu ,tatlı ,lezzetli bir panceke tarifi ile kahvaltılarınıza renk katın . Dolapta ne varsa yanına eşlik edebilir 🥞🌼 •1 yumurta •1 sb tambuğday unu •1/2 sb süt •1 çk karbonat •1 YK bal 
Tüm malzemeyi karıştır , ısıttığın yapışmaz bir tavaya kepçe yardımıyla karısımdan dök , üzeri göz göz olunca çevir , yanmasın 😉 afiyet olsun 🎈

#pancake #şekersizpancake #şekersizpancake #sekersiz #şekersizlezzetler #sağlıklıpancake #fitpancake #fithayat #sağlıklı #sağlıklıbeslenme #sağlıklıyaşıyoruz #sağlıklıyaşam #healty #healtyfood #healtycakes #healtypancakes
Sağlıklı PANCAKE 🥞

Kahvaltımızın vazgeçilmezi , doyurucu ,tatlı ,lezzetli bir panceke tarifi ile kahvaltılarınıza renk katın . Dolapta ne varsa yanına eşlik edebilir 🥞🌼 •1 yumurta •1 sb tambuğday unu •1/2 sb süt •1 çk karbonat •1 YK bal
Tüm malzemeyi karıştır , ısıttığın yapışmaz bir tavaya kepçe yardımıyla karısımdan dök , üzeri göz göz olunca çevir , yanmasın 😉 afiyet olsun 🎈

#pancake #şekersizpancake #şekersizpancake #sekersiz #şekersizlezzetler #sağlıklıpancake #fitpancake #fithayat #sağlıklı #sağlıklıbeslenme #sağlıklıyaşıyoruz #sağlıklıyaşam #healty #healtyfood #healtycakes #healtypancakes
Şekersiz ballı pancakeler yaptık arkadaşımla üzerinede bal döktük yanındada,cevizli gronala 🐥🥞🍯
Video çok tatlı olmamış mı😄
Tarifff
🥞1 yumurta🥚
🥞yarım su bardağı tam buğday unu
🥞yarım su bardağı süt🥛
🥞 2 tatlı kaşığı bal
🥞1 tatlı kaşığı erimiş tereyağ🧀
🥞yarım paket kabartma tozu
Tüm malzemeleri karıştırıp,yapışmayan tavayı önceden iyice ısıtıp,kaşık kaşık döküp,arkalı önlü pişiriyoruz🍽
Muzlu yapıyordum normalde un olmasın diye ama bu sefer normal pancake tarifini kendim uyarladım en sağlıklı haline🌈👑
#diyethesaplarıtakipleşiyor #fityaşam #şekersizbeslenme #diyetlistem #sağlıklıbeslenme #sugarfreelife #healtyfood #sağlıklıöğün #kiloverme #instafollow #şekersizpancake #fitpancake #sekersizpancake #sugarfreepancake #pancake
Şekersiz ballı pancakeler yaptık arkadaşımla üzerinede bal döktük yanındada,cevizli gronala 🐥🥞🍯
Video çok tatlı olmamış mı😄
Tarifff
🥞1 yumurta🥚
🥞yarım su bardağı tam buğday unu
🥞yarım su bardağı süt🥛
🥞 2 tatlı kaşığı bal
🥞1 tatlı kaşığı erimiş tereyağ🧀
🥞yarım paket kabartma tozu
Tüm malzemeleri karıştırıp,yapışmayan tavayı önceden iyice ısıtıp,kaşık kaşık döküp,arkalı önlü pişiriyoruz🍽
Muzlu yapıyordum normalde un olmasın diye ama bu sefer normal pancake tarifini kendim uyarladım en sağlıklı haline🌈👑
#diyethesaplarıtakipleşiyor #fityaşam #şekersizbeslenme #diyetlistem #sağlıklıbeslenme #sugarfreelife #healtyfood #sağlıklıöğün #kiloverme #instafollow #şekersizpancake #fitpancake #sekersizpancake #sugarfreepancake #pancake
Sahurda ya da iftarda canı tatlı çekenlere ya da sabah çocuşlara çok basit hazırlanabilecek sağlıklı nir alternatif;
Unsuz, Rafine Şekersiz Pancake
Tarif;
🍀 2 yumurta
🍀 2 y.k. kinoa unu @naturelkapowders
🍀 2 y.k. hindistan cevizi unu co&co marka
🍀 5 y.k. dut tozu @naturelkapowders
🍀 2 y.k. soğuk sıkım zeytinyağı
🍀 7 y.k. istediğiniz bir bitkisel süt (ben fındık sütü kullandım)
🍀 1 y.k. fındık sütünden kalan posa
🍀 1 ç.k. karbonat, 1 t.k. sirke
Karbonat ve sirkeyi bir kapta aktive edip kalan tüm malzemeleri üzerine ekleyip homojen olana kadar karıştırıyoruz.
Biraz zeytinyağı ile tavada kısık ateşte arkalı önlü pişiriyoruz.
Unsuz yaptığım en pufidik pancakeler oldu diyebilirim 😍 Dün akşam yemeğimiz kahvaltılık şeklinde oldu ve bu tatlışta masamızın favori parçasıydı 😂👌🏻
Nasıl servis edeceğiniz ise tamamen evde ki malzemelerinize kalıyor. Ben evde yoğurt yapımından kalan az bir kaymak, tahin pekmez karışımı ve meyvelerle lezzetine lezzet kattım 😊
Tadı damağımızda kaldı, her gün yapsak yenir cinsten 🙈 ama sonuçta sende bir kaçamaksın canım pancake 😋😅
Canı tatlı isteyen olursa, fikir vermek açısından iftar öncesi paylaştım.
Çok canımız istedi, iftardan önce paylaşma derseniz bundan sonra iftar sonrası paylaşırım 😊
Bu arada kinoa unu olmayanlar terine karabuğday, kuruyemiş tozu da kullanabilir. Dut tozunu da kendiniz hazırlayabilirsiniz 🙋🏻‍♀️
#temizbeslenme #sağlıklıyaşam #sağlıklıbeslenme #sağlık #bakliyat #protein #diyet #diyetteyiz #sporcubeslenmesi #fibromiyalji #lupus #multiplesclerosis #lyme #lymedisease #karabuğday #glutensiztarifler #glutensiz #pancake #şekersizpancake #unsuzpancake #kinoaunu #berrinatıştırmalık #berrinkahvaltısı
Sahurda ya da iftarda canı tatlı çekenlere ya da sabah çocuşlara çok basit hazırlanabilecek sağlıklı nir alternatif;
Unsuz, Rafine Şekersiz Pancake
Tarif;
🍀 2 yumurta
🍀 2 y.k. kinoa unu @naturelkapowders
🍀 2 y.k. hindistan cevizi unu co&co marka
🍀 5 y.k. dut tozu @naturelkapowders
🍀 2 y.k. soğuk sıkım zeytinyağı
🍀 7 y.k. istediğiniz bir bitkisel süt (ben fındık sütü kullandım)
🍀 1 y.k. fındık sütünden kalan posa
🍀 1 ç.k. karbonat, 1 t.k. sirke
Karbonat ve sirkeyi bir kapta aktive edip kalan tüm malzemeleri üzerine ekleyip homojen olana kadar karıştırıyoruz.
Biraz zeytinyağı ile tavada kısık ateşte arkalı önlü pişiriyoruz.
Unsuz yaptığım en pufidik pancakeler oldu diyebilirim 😍 Dün akşam yemeğimiz kahvaltılık şeklinde oldu ve bu tatlışta masamızın favori parçasıydı 😂👌🏻
Nasıl servis edeceğiniz ise tamamen evde ki malzemelerinize kalıyor. Ben evde yoğurt yapımından kalan az bir kaymak, tahin pekmez karışımı ve meyvelerle lezzetine lezzet kattım 😊
Tadı damağımızda kaldı, her gün yapsak yenir cinsten 🙈 ama sonuçta sende bir kaçamaksın canım pancake 😋😅
Canı tatlı isteyen olursa, fikir vermek açısından iftar öncesi paylaştım.
Çok canımız istedi, iftardan önce paylaşma derseniz bundan sonra iftar sonrası paylaşırım 😊
Bu arada kinoa unu olmayanlar terine karabuğday, kuruyemiş tozu da kullanabilir. Dut tozunu da kendiniz hazırlayabilirsiniz 🙋🏻‍♀️
#temizbeslenme #sağlıklıyaşam #sağlıklıbeslenme #sağlık #bakliyat #protein #diyet #diyetteyiz #sporcubeslenmesi #fibromiyalji #lupus #multiplesclerosis #lyme #lymedisease #karabuğday #glutensiztarifler #glutensiz #pancake #şekersizpancake #unsuzpancake #kinoaunu #berrinatıştırmalık #berrinkahvaltısı
Günaydın ☀️ Nefis bir glutensiz ve şekersiz pancake ile güne başlamak isteyen var mı?
Malzemeler:
🥥 2 yumurta
🥥 1 kahve fincanı hindistan cevizi unu
🥥 1 kahve fincanı badem unu
🥥 1 kahve fincanı kefir/yoğurt altı suyu 🥥 1 çorba kaşığı @secret.farm elma suyu konsantresi
🥥 1 çay kaşığı kabartma tozu
🥥 1 yemek kaşığı h.cevizi yağı
🥥 1 fiske tuz
Yapılışı:
Yumurtaları güzelce çırpıyorum. Yoğurt veya kefir suyu ile sulandırıyorum. Evde varsa süt de olur, hiç bir şey yoksa su da olur. Badem ve hindistan cevizi ununu ve diğer malzemeleri ekleyip bi 5 dk unun sıvıları içine çekmesi için  bekliyorum. Kıvamını 3. görselde görebilirsiniz. Ben badem unumu evde kendim yapıyorum. Oğlumun diyetinde süt olmadığı için her ay 1 kg çiğ bademden badem sütü yapıp donduruyorum. Süt yapımından artan bademleri fırında 100 derecede 2-3 saatte kurutup değirmende öğütüyorum. Elimde bolca ev yapımı badem unu oluyor böylece. Hazır badem unu şimdiye kadar hiç kullanmadığım için sıvı kaldırma kapasitesini bilemiyorum. Tarifteki ölçülere göre kıvamını ayarlamanız gerekebilir. Pancake tavasını ısıtıp önlü arkalı pişiriyorum. Ev yapımı vegan çikolata ile çok uyumlu oldu. #glutensiztarifler #glutensizpancake #pancake #glutensizkahvaltı #şekersizpancake #sekersiztarifler
Günaydın ☀️ Nefis bir glutensiz ve şekersiz pancake ile güne başlamak isteyen var mı?
Malzemeler:
🥥 2 yumurta
🥥 1 kahve fincanı hindistan cevizi unu
🥥 1 kahve fincanı badem unu
🥥 1 kahve fincanı kefir/yoğurt altı suyu 🥥 1 çorba kaşığı @secret.farm elma suyu konsantresi
🥥 1 çay kaşığı kabartma tozu
🥥 1 yemek kaşığı h.cevizi yağı
🥥 1 fiske tuz
Yapılışı:
Yumurtaları güzelce çırpıyorum. Yoğurt veya kefir suyu ile sulandırıyorum. Evde varsa süt de olur, hiç bir şey yoksa su da olur. Badem ve hindistan cevizi ununu ve diğer malzemeleri ekleyip bi 5 dk unun sıvıları içine çekmesi için bekliyorum. Kıvamını 3. görselde görebilirsiniz. Ben badem unumu evde kendim yapıyorum. Oğlumun diyetinde süt olmadığı için her ay 1 kg çiğ bademden badem sütü yapıp donduruyorum. Süt yapımından artan bademleri fırında 100 derecede 2-3 saatte kurutup değirmende öğütüyorum. Elimde bolca ev yapımı badem unu oluyor böylece. Hazır badem unu şimdiye kadar hiç kullanmadığım için sıvı kaldırma kapasitesini bilemiyorum. Tarifteki ölçülere göre kıvamını ayarlamanız gerekebilir. Pancake tavasını ısıtıp önlü arkalı pişiriyorum. Ev yapımı vegan çikolata ile çok uyumlu oldu. #glutensiztarifler #glutensizpancake #pancake #glutensizkahvaltı #şekersizpancake #sekersiztarifler
İştahımı açıyor 😋
Makes me feel hungry 😋
.
.
.
#sağlıklıtarifler #kahvaltı #kahvaltıtarifleri #sağlıklıyaşıyoruz #dengelibeslenme #diyetyemekleri #temizbeslenme #diyethesaplaritakiplesiyor #kilokoruma #sağlıklıpancake #şekersizpancake #çileklipancake #diyetönerileri #freshbeslenme #healthyrecipes #healthynutrition #eatclean #breakfastideas #pancakerecipe #healthypancake #strawberrypancake
G Ü N A Y D I N 🥬 
Bugün kahvaltı için YEŞİL KREP yaptım 😋
Ben çok çektirmedim ıspanaklar hafif tane kaldı siz tam blenderdan gecerseniz pürüzsüz sadece yeşil olur😍
İşteeeee Malzemeler;
10 yaprak temizlenmiş ıspanak
1 su bardağı süt
1 su bardağı yulaf unu
2 yumurta
Bir tutam tuz
Yapılışı; 
Süt, ıspanak, yumurta ve tuzu mikserden geçiyoruz. Sonra yulaf ununu ekleyip tekrar blenderdan geciyoruz ve fırça yardımıyla az yağlamış olduğumuz tavada pişiriyoruz.
Üzerine tatlı veya tuzlu ne dilerseniz sürüp afiyetle yiyebilirsiniz 🤤
🇬🇧 G O O D  M O R N I N G 🥬
I made GREEN CREPE for breakfast 😋
Here comes ingredients ;
10 leaves washed spinach
2 eggs
150-200 ml milk
5-6 tbsp oat flour 
A pinch of salt 
Preparation;
Mix milk, egg, spinach and salt by blender then add oat flour and stir until there is no sediment. Oil the pan with the help of a brush then cook the crepes.
You can eat them sweet or salty whatever you wish🤤
.
.
.
#sağlıklıtarifler #kahvaltı #kahvaltıtarifleri #sağlıklıyaşıyoruz #dengelibeslenme #diyetyemekleri #temizbeslenme #diyethesaplaritakiplesiyor #kilokoruma #sağlıklıpancake #şekersizpancake #ıspanaklıktep #diyetönerileri #freshbeslenme #healthyrecipes #healthynutrition #eatclean #breakfastideas #pancakerecipe #healthypancake #spinachcrepe
G Ü N A Y D I N 🥬
Bugün kahvaltı için YEŞİL KREP yaptım 😋
Ben çok çektirmedim ıspanaklar hafif tane kaldı siz tam blenderdan gecerseniz pürüzsüz sadece yeşil olur😍
İşteeeee Malzemeler;
10 yaprak temizlenmiş ıspanak
1 su bardağı süt
1 su bardağı yulaf unu
2 yumurta
Bir tutam tuz
Yapılışı;
Süt, ıspanak, yumurta ve tuzu mikserden geçiyoruz. Sonra yulaf ununu ekleyip tekrar blenderdan geciyoruz ve fırça yardımıyla az yağlamış olduğumuz tavada pişiriyoruz.
Üzerine tatlı veya tuzlu ne dilerseniz sürüp afiyetle yiyebilirsiniz 🤤
🇬🇧 G O O D M O R N I N G 🥬
I made GREEN CREPE for breakfast 😋
Here comes ingredients ;
10 leaves washed spinach
2 eggs
150-200 ml milk
5-6 tbsp oat flour
A pinch of salt
Preparation;
Mix milk, egg, spinach and salt by blender then add oat flour and stir until there is no sediment. Oil the pan with the help of a brush then cook the crepes.
You can eat them sweet or salty whatever you wish🤤
.
.
.
#sağlıklıtarifler #kahvaltı #kahvaltıtarifleri #sağlıklıyaşıyoruz #dengelibeslenme #diyetyemekleri #temizbeslenme #diyethesaplaritakiplesiyor #kilokoruma #sağlıklıpancake #şekersizpancake #ıspanaklıktep #diyetönerileri #freshbeslenme #healthyrecipes #healthynutrition #eatclean #breakfastideas #pancakerecipe #healthypancake #spinachcrepe
Missss gibi bir güne
G Ü N A Y D I N🍓
Çilekli ŞEKERSİZ YAĞSIZ tek kişilik pancake tarifi için malzemeler;
1 orta muz
2 yk yulaf unu
1 tane yumurta
Yarım çk kabartma tozu
3 tane dilimlenmiş çilek 
Üzeri için; 
Bal ve çilek
Hazırlanışı;
Muzu çatal yardımıyla ezip yumurta ve yulaf ununu karıştırıp fırça yardımıyla yağladığımız tavaya döküyoruz.
İki tane büyük pancake çıkıyor. Üzerine çilekleri dizip balı döküyoruz.
Afiyet olsun 😋 🇬🇧 G O O D  M O R N I N G to a beautiful day 🍓
SUGAR FREE, FAT FREE strawberry pancake for single dish
Ingredients;
1 egg
1 medium banana
2 tbsp oat flour 
Half of tsp baking powder
3 chopped strawberries 
For topping;
Honey and strawberries
Preparation;
Crush the banana with the help of a fork and mix the egg, baking powder and oat flour. After string all ingredients mold the mixture to oily pan. We get 2 medium size pancakes.
Then decorate your meal with strawberries and honey.
Enjoy your meal 😋
.
.
.
#sağlıklıtarifler #kahvaltı #kahvaltıtarifleri #sağlıklıyaşıyoruz #dengelibeslenme #diyetyemekleri #temizbeslenme #diyethesaplaritakiplesiyor #kilokoruma #sağlıklıpancake #şekersizpancake #çileklipancake #diyetönerileri #freshbeslenme #healthyrecipes #healthynutrition #eatclean #breakfastideas #pancakerecipe #healthypancake #strawberrypancake
Missss gibi bir güne
G Ü N A Y D I N🍓
Çilekli ŞEKERSİZ YAĞSIZ tek kişilik pancake tarifi için malzemeler;
1 orta muz
2 yk yulaf unu
1 tane yumurta
Yarım çk kabartma tozu
3 tane dilimlenmiş çilek
Üzeri için;
Bal ve çilek
Hazırlanışı;
Muzu çatal yardımıyla ezip yumurta ve yulaf ununu karıştırıp fırça yardımıyla yağladığımız tavaya döküyoruz.
İki tane büyük pancake çıkıyor. Üzerine çilekleri dizip balı döküyoruz.
Afiyet olsun 😋 🇬🇧 G O O D M O R N I N G to a beautiful day 🍓
SUGAR FREE, FAT FREE strawberry pancake for single dish
Ingredients;
1 egg
1 medium banana
2 tbsp oat flour
Half of tsp baking powder
3 chopped strawberries
For topping;
Honey and strawberries
Preparation;
Crush the banana with the help of a fork and mix the egg, baking powder and oat flour. After string all ingredients mold the mixture to oily pan. We get 2 medium size pancakes.
Then decorate your meal with strawberries and honey.
Enjoy your meal 😋
.
.
.
#sağlıklıtarifler #kahvaltı #kahvaltıtarifleri #sağlıklıyaşıyoruz #dengelibeslenme #diyetyemekleri #temizbeslenme #diyethesaplaritakiplesiyor #kilokoruma #sağlıklıpancake #şekersizpancake #çileklipancake #diyetönerileri #freshbeslenme #healthyrecipes #healthynutrition #eatclean #breakfastideas #pancakerecipe #healthypancake #strawberrypancake
@saglikla_yasayalim Gunaydınlar.. Kahvaltıda pancake sevmeyen var mı;) Tadı biraz mayhoş ama çok güzel ve hafif bir tarife ne dersiniz
Tarif➡️
✔️Glutensiz yulafı un haline getirin(1 bardak) veya karabugday/nohut/kinoa ya da istediginiz herhangi bir un
✔️2 yumurta ve 2 kaşık zeytinyağını çırpıp içine 1 kaşık yoğurt ekleyip çırpmaya devam edin
✔️Unları, istediğiniz kadar yaban mersinini(ben donmuş kullandım), 1 tatlı kaşığı karbonatı (üzerine biraz limon) çırpılmış yumurtalara ekleyin
✔️Tavada arkalı önlü pişirin
Afiyet olsun

#sagliklayasayalimkahvaltialternatifleri  #sagliklayasayalimtatlikacamaklar  #glutensizpancake  #instafood  #şekersizpancake  #glutenfree  #glutenfreerecipes  #glutenfreepancakes  #sekersizhayat  #sugarfree  #cleaneating  #temizbeslenme  #saglikliyasam
@saglikla_yasayalim Gunaydınlar.. Kahvaltıda pancake sevmeyen var mı;) Tadı biraz mayhoş ama çok güzel ve hafif bir tarife ne dersiniz
Tarif➡️
✔️Glutensiz yulafı un haline getirin(1 bardak) veya karabugday/nohut/kinoa ya da istediginiz herhangi bir un
✔️2 yumurta ve 2 kaşık zeytinyağını çırpıp içine 1 kaşık yoğurt ekleyip çırpmaya devam edin
✔️Unları, istediğiniz kadar yaban mersinini(ben donmuş kullandım), 1 tatlı kaşığı karbonatı (üzerine biraz limon) çırpılmış yumurtalara ekleyin
✔️Tavada arkalı önlü pişirin
Afiyet olsun

#sagliklayasayalimkahvaltialternatifleri #sagliklayasayalimtatlikacamaklar #glutensizpancake #instafood #şekersizpancake #glutenfree #glutenfreerecipes #glutenfreepancakes #sekersizhayat #sugarfree #cleaneating #temizbeslenme #saglikliyasam
Gunaydınlar.. Kahvaltıda pancake sevmeyen var mı;) Tadı biraz mayhoş ama çok güzel ve hafif bir tarife ne dersiniz
Tarif➡️
✔️Glutensiz yulafı un haline getirin(1 bardak) veya karabugday/nohut/kinoa ya da istediginiz herhangi bir un
✔️2 yumurta ve 2 kaşık zeytinyağını çırpıp içine 1 kaşık yoğurt ekleyip çırpmaya devam edin
✔️Unları, istediğiniz kadar yaban mersinini(ben donmuş kullandım), 1 tatlı kaşığı karbonatı (üzerine biraz limon) çırpılmış yumurtalara ekleyin
✔️Tavada arkalı önlü pişirin
Afiyet olsun

#sagliklayasayalimkahvaltialternatifleri  #sagliklayasayalimtatlikacamaklar  #glutensizpancake  #instafood  #şekersizpancake  #glutenfree  #glutenfreerecipes  #glutenfreepancakes  #sekersizhayat  #sugarfree  #cleaneating  #temizbeslenme  #saglikliyasam #sagliklayasayalimhafifatistirmalik
Gunaydınlar.. Kahvaltıda pancake sevmeyen var mı;) Tadı biraz mayhoş ama çok güzel ve hafif bir tarife ne dersiniz
Tarif➡️
✔️Glutensiz yulafı un haline getirin(1 bardak) veya karabugday/nohut/kinoa ya da istediginiz herhangi bir un
✔️2 yumurta ve 2 kaşık zeytinyağını çırpıp içine 1 kaşık yoğurt ekleyip çırpmaya devam edin
✔️Unları, istediğiniz kadar yaban mersinini(ben donmuş kullandım), 1 tatlı kaşığı karbonatı (üzerine biraz limon) çırpılmış yumurtalara ekleyin
✔️Tavada arkalı önlü pişirin
Afiyet olsun

#sagliklayasayalimkahvaltialternatifleri #sagliklayasayalimtatlikacamaklar #glutensizpancake #instafood #şekersizpancake #glutenfree #glutenfreerecipes #glutenfreepancakes #sekersizhayat #sugarfree #cleaneating #temizbeslenme #saglikliyasam #sagliklayasayalimhafifatistirmalik
Sağlıklı şekersiz  pancake tarifi : kızım olduktan sonra doğal olsun sağlıklı olsun diye kafayı yemiş bir anne olarak elimden geldiğinde şekerli gıdalardan koruyorum. Hazır paketli hiçbir yiyecek vermiyorum. (Bazen büyükler zor durumda bıraksada 😊)
Bu pancake i büyük küçük herkes afiyetle yiyebilir. Göz kararı koyuyorum malzemeleri.

1 çay bardağı süt
1 yumurta 
2 minik yerli muz
2 kaşık keçiboynuzu unu 
Biraz karbonat ve çok az kabartma tozu
Göz kararı un (siyez unu tam buğday,yulaf olabilir isteğe bağlı)
1 çay kaşığı chia tohumu (isteğe bağlı)
2 kaşık şekersiz pekmez 
Tüm malzemeleri karıştırıp yoğun bir hamur elde ediyoruz. Ve kaşıkla döküp afiyetle yiyoruz 
#annetarifleri #sağlıklıtarifler #blwturkiye #blw #blwtarifleri #blwanneleri #annekız #doğalanne #sağlıklıyaşam #doğaltarifler #şekersizpancake #pancake #şekerehayır #samsun #seda_ogretmenn #seda_ogretmentarifler @blwturkiye @blwyemektarifleri
Sağlıklı şekersiz pancake tarifi : kızım olduktan sonra doğal olsun sağlıklı olsun diye kafayı yemiş bir anne olarak elimden geldiğinde şekerli gıdalardan koruyorum. Hazır paketli hiçbir yiyecek vermiyorum. (Bazen büyükler zor durumda bıraksada 😊)
Bu pancake i büyük küçük herkes afiyetle yiyebilir. Göz kararı koyuyorum malzemeleri.

1 çay bardağı süt
1 yumurta
2 minik yerli muz
2 kaşık keçiboynuzu unu
Biraz karbonat ve çok az kabartma tozu
Göz kararı un (siyez unu tam buğday,yulaf olabilir isteğe bağlı)
1 çay kaşığı chia tohumu (isteğe bağlı)
2 kaşık şekersiz pekmez
Tüm malzemeleri karıştırıp yoğun bir hamur elde ediyoruz. Ve kaşıkla döküp afiyetle yiyoruz
#annetarifleri #sağlıklıtarifler #blwturkiye #blw #blwtarifleri #blwanneleri #annekız #doğalanne #sağlıklıyaşam #doğaltarifler #şekersizpancake #pancake #şekerehayır #samsun #seda_ogretmenn #seda_ogretmentarifler @blwturkiye @blwyemektarifleri
Banana  protein pancake:🥞🥞🥞
2 yumurta 🥚🥚
1 büyük olgunlaşmış muz🍌
Birazcıkkk kabartma tozu 
Hepsini iyice ezip karıştırıp az yağlanmış tavada 🍳pişiriyoruz🤗🌈
Tadı çook güzel
Tercihe göre içine kakao tarçın pekmez bal ekleyebilirsiniz.
Birde kahvaltıda yeterli protein almamızıda sağlıyor. 
#bananapancake #fitpancake #healthypancake #şekersizpancake #şekersizpankek #sağlıklıkahvaltı #fitkahvaltı #proteinpancake #unsuzpankek #diyetlistesi #diyethesaplarıtakipleşiyor #diyethesapları #nosugarnonono
Banana protein pancake:🥞🥞🥞
2 yumurta 🥚🥚
1 büyük olgunlaşmış muz🍌
Birazcıkkk kabartma tozu
Hepsini iyice ezip karıştırıp az yağlanmış tavada 🍳pişiriyoruz🤗🌈
Tadı çook güzel
Tercihe göre içine kakao tarçın pekmez bal ekleyebilirsiniz.
Birde kahvaltıda yeterli protein almamızıda sağlıyor.
#bananapancake #fitpancake #healthypancake #şekersizpancake #şekersizpankek #sağlıklıkahvaltı #fitkahvaltı #proteinpancake #unsuzpankek #diyetlistesi #diyethesaplarıtakipleşiyor #diyethesapları #nosugarnonono
Biz bu cumartesi kahvaltısına muzlu fit pancake yaptık☺️ tarifimiz tabiiki ŞEKERSİZ 😉 Muzlu fit pancake  Malzemeler
•1adet muz •1yumurta •3 yemek kaşığı süt •1tatlı kaşığı tam buğday unu 
Bütün malzemeleri rondoya atıyoruz ve bir güzel çektikten sonra az yağlanmış tavaya  birer kaşık ekleyerek minik pancakeler pişiriyoruz. Üzerini tarçın susam taze meyveler bal ile süsleyebilirsiniz afiyet olsun☺️ #fitpancake #muzlupancake #şekersizpancake #şekersizbesleniyorum #şekersizdokuzuncugün #fittarifler #sağlıklıtarif #temizbeslenme #cumartesikahvaltısı #kahvaltı #pancake #çoklezzetli #bugünnepişirsem #yemektenevar
Biz bu cumartesi kahvaltısına muzlu fit pancake yaptık☺️ tarifimiz tabiiki ŞEKERSİZ 😉 Muzlu fit pancake Malzemeler
•1adet muz •1yumurta •3 yemek kaşığı süt •1tatlı kaşığı tam buğday unu
Bütün malzemeleri rondoya atıyoruz ve bir güzel çektikten sonra az yağlanmış tavaya birer kaşık ekleyerek minik pancakeler pişiriyoruz. Üzerini tarçın susam taze meyveler bal ile süsleyebilirsiniz afiyet olsun☺️ #fitpancake #muzlupancake #şekersizpancake #şekersizbesleniyorum #şekersizdokuzuncugün #fittarifler #sağlıklıtarif #temizbeslenme #cumartesikahvaltısı #kahvaltı #pancake #çoklezzetli #bugünnepişirsem #yemektenevar
Günaydın😊
.
Her lokması bitter çikolata tadında ama içinde çikolata ya da kakao yok. Mis gibi de portakal aroması yanında bonusu 🍊 tatlı ama şekersiz 😊 bütün bu lezzetlerin sırrı @mostnatural35 keçiboynuzu unu ve önceden aromalandırılmış sütten geliyor. Birkaç çeşit un karışımını da ayrıca ekledim, glutensiz beslenenler için 😊
.
Sağlıklı tarifler de güzeldir. Bu nefis pancake tarifine profilimdeki linkten ‘KEKLER’ bölümünden bakabilirsiniz.
.
.
#mostnatural35 
#pancakes #breakfast #keciboynuzuunu #carobflour #glutenfree #sugarfree #şekersizpancake #glutensizpancake #foodblog
@pikniktupumuo
Günaydın😊
.
Her lokması bitter çikolata tadında ama içinde çikolata ya da kakao yok. Mis gibi de portakal aroması yanında bonusu 🍊 tatlı ama şekersiz 😊 bütün bu lezzetlerin sırrı @mostnatural35 keçiboynuzu unu ve önceden aromalandırılmış sütten geliyor. Birkaç çeşit un karışımını da ayrıca ekledim, glutensiz beslenenler için 😊
.
Sağlıklı tarifler de güzeldir. Bu nefis pancake tarifine profilimdeki linkten ‘KEKLER’ bölümünden bakabilirsiniz.
.
.
#mostnatural35
#pancakes #breakfast #keciboynuzuunu #carobflour #glutenfree #sugarfree #şekersizpancake #glutensizpancake #foodblog
@pikniktupumuo
🍓🥞Unsuz P A N C A K E 🥞🍓
‼️Un, yağ ve şeker içermez‼️
Pazartesi sendromu da neymiş 🤤🤤🤤
👉🏼👉🏼👉🏼Yulaf kepeği, soya sütü ve muzlu pancake üzerine karamelize muz& taze çilek 🍌🍌🍌 yanında fıstık ezmesi ve pancake şurubu 🥞🥞🥞
.
.
#sagliklisecimler / #healthychoices
#saglik #saglikliyasam #sagliklibeslenme #dengelibeslenme #healthy #cleaneating #inspiration #motivation #healthyfood #foodphotography #healthyeating #foodblogger #instamood #popularplaces #yenimekan #healthblog #saglıklıyaşam #sagliklizayiflama #saglikli #sagliklitarifler #kahvaltı #morning #breakfast #pancake #unsuzpancake #şekersizpancake
🍓🥞Unsuz P A N C A K E 🥞🍓
‼️Un, yağ ve şeker içermez‼️
Pazartesi sendromu da neymiş 🤤🤤🤤
👉🏼👉🏼👉🏼Yulaf kepeği, soya sütü ve muzlu pancake üzerine karamelize muz& taze çilek 🍌🍌🍌 yanında fıstık ezmesi ve pancake şurubu 🥞🥞🥞
.
.
#sagliklisecimler / #healthychoices
#saglik #saglikliyasam #sagliklibeslenme #dengelibeslenme #healthy #cleaneating #inspiration #motivation #healthyfood #foodphotography #healthyeating #foodblogger #instamood #popularplaces #yenimekan #healthblog #saglıklıyaşam #sagliklizayiflama #saglikli #sagliklitarifler #kahvaltı #morning #breakfast #pancake #unsuzpancake #şekersizpancake

Socview is explorer of social posts and media.